PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.002G185900.1
Common NamePOPTR_0002s18700g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family MYB
Protein Properties Length: 465aa    MW: 51818.6 Da    PI: 7.1384
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.002G185900.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.84.5e-171461148
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
     Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                        +g W++eEde+l+  ++++G g+W+++++  g+ R++k+c++rw +yl
  Potri.002G185900.1 14 KGLWSPEEDEKLLSHITKYGHGCWSSVPKQAGLQRCGKSCRLRWINYL 61
                        678*******************************************97 PP

2Myb_DNA-binding39.21.6e-1267110146
                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
     Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                         rg ++  E+ l++++++ lG++ W+ Ia+ ++ gRt++++k+ w++
  Potri.002G185900.1  67 RGTFSHLEENLIIELHAVLGNR-WSQIAAQLP-GRTDNEIKNLWNS 110
                         7999******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.609.5E-28664IPR009057Homeodomain-like
PROSITE profilePS5129424.811965IPR017930Myb domain
SuperFamilySSF466892.51E-2812108IPR009057Homeodomain-like
SMARTSM007179.0E-131363IPR001005SANT/Myb domain
PfamPF002495.8E-151461IPR001005SANT/Myb domain
CDDcd001671.83E-111761No hitNo description
Gene3DG3DSA:1.10.10.605.7E-2465117IPR009057Homeodomain-like
SMARTSM007172.9E-1166114IPR001005SANT/Myb domain
PROSITE profilePS5129418.70566116IPR017930Myb domain
PfamPF002491.3E-1167111IPR001005SANT/Myb domain
CDDcd001671.09E-769109No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 465 aa     Download sequence    Send to blast
MGRHSCCYKQ KLRKGLWSPE EDEKLLSHIT KYGHGCWSSV PKQAGLQRCG KSCRLRWINY  60
LRPDLKRGTF SHLEENLIIE LHAVLGNRWS QIAAQLPGRT DNEIKNLWNS CLKKKLKQRG  120
IDPVTHKPLS EVEDGEDKNP AASRNQDKAS AVSNTELNLL KADHSKPLGA NLQEKRSSSI  180
SPHGNQLERE STSSFKAMNE NNNNTNDHGN NNLMTPTSNK DFFFDRFTAF LHEGSTSNCP  240
PSGFVGHFPL QQLNYASNAR LATNSIPSLW LSQTSKAFGM NCEFSSTMIP SIPPPAVTSS  300
FLSSSMGYKP SITVPPDNPS LPSFTTNSYR PWETGAPSNN SNSSTGSNGS TELQSNSSFF  360
ENTIFSWGLG DCSSTEKEAQ NHLIGSQQED IRWPEYLQNP LLMAASLQNQ NQQSLYNEIK  420
TETHLLTENP SGMWPDNQQE QEPLQNPDIC PKDMQRITAS YGYV*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-27121165108B-MYB
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1111117LKKKLKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB9707840.0AB970784.1 Populus nigra PniMYB055 mRNA for MYB transcriptional factor, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002302702.10.0hypothetical protein POPTR_0002s18700g
TrEMBLB9GRW70.0B9GRW7_POPTR; Uncharacterized protein
STRINGPOPTR_0002s18700.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF108333103
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G09540.13e-96myb domain protein 61